PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004504539.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family M-type_MADS
Protein Properties Length: 178aa    MW: 20243.3 Da    PI: 10.1643
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004504539.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.21.8e-221257449
                    -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    ++   rqvtfskRr+g++KKA+ELS+LC+aeva+++fs+ +k y +
  XP_004504539.1 12 KDPNTRQVTFSKRRTGLFKKANELSILCGAEVAIVVFSPGNKPYSF 57
                    67778**********************************9998877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.57E-27172IPR002100Transcription factor, MADS-box
SMARTSM004322.6E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.983161IPR002100Transcription factor, MADS-box
CDDcd001202.56E-30260No hitNo description
PRINTSPR004041.5E-20323IPR002100Transcription factor, MADS-box
PfamPF003191.0E-251157IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-202338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-203859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MGRRKIEIEM VKDPNTRQVT FSKRRTGLFK KANELSILCG AEVAIVVFSP GNKPYSFGHP  60
GVDVVAAKFL QQDSKPIDSH GNPSSDSSNM EKLNLELAEV LAQIREGEKH SEAQDQILKQ  120
HNISKLQLQD LRDSYQILQD RIKLRLSDIE ISEYMMLLSQ DPVVGIKTKS LKKKRRRN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S3e-18183182Myocyte-specific enhancer factor 2B
1tqe_R3e-18183182Myocyte-specific enhancer factor 2B
1tqe_Q3e-18183182Myocyte-specific enhancer factor 2B
1tqe_P3e-18183182Myocyte-specific enhancer factor 2B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1171176KKKRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004504539.11e-129PREDICTED: agamous-like MADS-box protein AGL61
SwissprotO647038e-40AGL29_ARATH; Agamous-like MADS-box protein AGL29
TrEMBLA0A072VIJ31e-100A0A072VIJ3_MEDTR; MADS-box transcription factor family protein
STRINGGLYMA05G35820.11e-72(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24242979
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.15e-41AGAMOUS-like 29